This referred to a Peptide comprising the Amino Acid Sequence ltlrkepaseiaqsileaysqngwanrrsggkrp, in which amino acids in this Sequence are residues of D - amino acidA Peptide that has at least 70% identity with the sequence or a Peptide fragment,Which feature of Apoptosis Inducing activity in senescent cells or cells that have a foxo4 expression increased.It also relates to a Pharmaceutical composition containing, being useful in the treatment of age-related disorders, such as atherosclerosis,Chronic inflammatory diseases, cancer, arthritis or Osteoarthritis, Scoliosis, among others
展开▼